PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g047290m
Common NameCISIN_1g047290mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Dof
Protein Properties Length: 173aa    MW: 19355.7 Da    PI: 8.8848
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g047290mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1245e-3944102260
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                        ++k+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk k 
  orange1.1g047290m  44 PDKIIPCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKTKP 102
                        68999***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2943101IPR003851Zinc finger, Dof-type
PfamPF027016.4E-3246101IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.36948102IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105086IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010214Biological Processseed coat development
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MGNDEEEQGI KLFGKTITLH GRQVKEEQNQ RGSDQPQAVV DKRPDKIIPC PRCKSMETKF  60
CYFNNYNVNQ PRHFCKGCQR YWTAGGALRN VPVGAGRRKT KPPGRGLPDG CLYDVASGDH  120
HHQLLHHQLD QFDLEGVFVE DWHPAAAAHG YGGFQNAFPV KRRRSNSGGQ LC*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00166DAPTransfer from AT1G29160Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0066931e-47AP006693.1 Lotus japonicus genomic DNA, chromosome 4, clone: LjT35C17, TM0399, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006467652.21e-128PREDICTED: dof zinc finger protein DOF1.5, partial
SwissprotP683501e-61DOF15_ARATH; Dof zinc finger protein DOF1.5
TrEMBLA0A067GR941e-128A0A067GR94_CITSI; Uncharacterized protein
STRINGVIT_10s0003g01260.t015e-70(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28092669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34140.11e-60Dof family protein